PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00011916-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 561aa    MW: 64085.7 Da    PI: 6.5433
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00011916-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR185.48.9e-2778164188
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fY++YA+ vGFsvrk+  ++sk +g++++r+f+Cs++g+r+++k++ ++ +++r+etrtgC a ++v++++dgk+ vt++e eHnHe
  SMil_00011916-RA_Salv  78 RFYHKYAELVGFSVRKDWVNRSKVHGRVMSRKFTCSRQGHRKKDKRD-VNVKKHRKETRTGCLAYMVVTRQTDGKYLVTQFEAEHNHE 164
                            5*******************************************999.999************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.0E-2478164IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MFAFAVGRRA MDVNEGEEVM NHENDVDVRM SNNLDLNVEH DCRSPKSSNV NGVRSRRSLK  60
HEVLKLGTEF DSDEQAYRFY HKYAELVGFS VRKDWVNRSK VHGRVMSRKF TCSRQGHRKK  120
DKRDVNVKKH RKETRTGCLA YMVVTRQTDG KYLVTQFEAE HNHEDVNLTK AERLLESPSG  180
KGNSTEVSET DSLKNSEIQS KLSFQMLAWD SMLERHGLCN NAWLRWMYRE KEKWAVAYGR  240
NTFFIERNGT HLVELLSDKL RSCLGLDIDV LQFFKHFENV VNEQRYRELE STLDMGRHAP  300
VLMANAILLK HPSETYTPKA FEVFQREYEK CLNVIIDKAA ESDPAFEYAS RQLDEVTRGI  360
ERILNFKTFE EAKGPCASDN ELADVGIDRN DFEDQDVDVM KGTTEAGSIV PDKDQLNHCG  420
EQIPGVGGNL NIHPSPPETV LSVACAPPTY ISSPSPAPSL SPLTQGLYTI ESSHMVQSMY  480
QASNLTINQQ ANPNMYEPSS FYSNQHHSPS HAQFLQESLI HSQFQDPVSN GNQLKQVMDD  540
SQHLHPSSFM HYNHRYRAAG V
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101184.11e-109PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_011101183.11e-109PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A022PT462e-93A0A022PT46_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30211740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.14e-18FAR1 family protein